You have no items in your shopping cart.
Human IGF1 protein (Active)
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.Coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using serum free human MCF-7 cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 x 10 ^ 5 IU/mg. |
| Tag | Tag-Free |
| Molecular Weight | 7.4 kDa |
| Expression Region | 52-118aa |
| Protein Length | Partial |
| Protein Sequence | TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
| Purity | > 97% as determined by SDS-PAGE and HPLC. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Recombinant human IGF-1 protein (Active, HEK293) [orb2978614]
≥ 95% as determined by SDS-PAGE.
7.7 kDa
500 μg, 50 μg, 10 μgRecombinant human LR3 IGF1 protein (Active, CHO) [orb2978615]
≥ 95% as determined by SDS-PAGE.
9 kDa
10 μg, 500 μg, 50 μgRecombinant Human Insulin-like growth factor I protein (IGF1),15N Stable Isotope Labeled (Active) [orb1785080]
Greater than 97% as determined by SDS-PAGE.
7.7 kDa
E.Coli
500 μg, 100 μg, 10 μgRecombinant Human Insulin-like growth factor I protein(IGF1) (Active) [orb1631369]
>97% as determined by SDS-PAGE and HPLC.
7.7 kDa
250 μg, 50 μg, 1 mg, 500 μg, 10 μgRecombinant Human Insulin-like growth factor I protein(IGF1) (Active) [orb1650683]
>95% as determined by SDS?PAGE and HPLC.
9.1 kDa
100 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

SDS-PAGE analysis of Human IGF1 protein (Active)
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Human IGF1 protein (Active) (orb359162)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review