You have no items in your shopping cart.
Human IGF1 protein (Active)
SKU: orb359162
Featured
Description
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.Coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using serum free human MCF-7 cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 × 105 IU/mg. |
| Tag | Tag-Free |
| Molecular Weight | 7.4 kDa |
| Expression Region | 52-118aa |
| Protein Length | Partial |
| Protein Sequence | TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
| Purity | > 97% as determined by SDS-PAGE and HPLC. |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
| Disclaimer | For research use only |
Alternative Names
−IGF-I, MGF, Somatomedin-C
Similar Products
−Recombinant Human Insulin-like growth factor I protein (IGF1),15N Stable Isotope Labeled (Active) [orb1785080]
Greater than 97% as determined by SDS-PAGE.
7.7 kDa
E.Coli
10 μg, 100 μg, 500 μgRecombinant human IGF-1 protein (Active, HEK293) [orb2978614]
≥ 95% as determined by SDS-PAGE.
7.7 kDa
500 μg, 50 μg, 10 μgRecombinant human LR3 IGF1 protein (Active, CHO) [orb2978615]
≥ 95% as determined by SDS-PAGE.
9 kDa
500 μg, 50 μg, 10 μgRecombinant Human Insulin-like growth factor I protein(IGF1) (Active) [orb1650681]
1 mg, 500 μg, 100 μgRecombinant Human Insulin-like growth factor I protein(IGF1) (Active) [orb1650682]
20 μg, 100 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

SDS-PAGE analysis of Human IGF1 protein (Active)
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human IGF1 protein (Active) (orb359162)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review