You have no items in your shopping cart.
Mouse Egf protein
Description
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Biological Activity | The ED50 as determined by its ability to inhibits the proliferation of human epithelial A431 cells is 2-20 ng/ml. |
| Tag | C-terminal 6xHis-tagged |
| Molecular Weight | 7.2 kDa |
| Expression Region | 977-1029aa |
| Protein Length | Partial |
| Protein Sequence | NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−U1A/SNRPA Antibody [orb1474823]
ELISA, ICC, IF, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μgMouse Milk Fat Globule EGF Factor 8 (MFGE8) ELISA Kit [orb775244]
Mouse
15.63-1000 pg/mL
6 pg/mL
48 T, 96 TMouse TEK Tyrosine Kinase, Endothelial (Tie2) ELISA Kit [orb775171]
Mouse
0.16-10 ng/mL
0.056 ng/mL
96 T, 48 TMouse Tyrosine Kinase with Immunoglobulin Like and EGF Like Domains Protein 1 (Tie1) ELISA Kit [orb776387]
Mouse
0.63-40 ng/mL
0.266 ng/mL
48 T, 96 T

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Mouse Egf protein (orb594763)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review






























