You have no items in your shopping cart.
Featured
Active
Description
Research Area
Cancer Biology
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Biological Activity | The ED50 as determined by its ability to inhibits the proliferation of human epithelial A431 cells is 2-20 ng/ml. |
| Tag | C-terminal 6xHis-tagged |
| Expression Region | 977-1029aa |
| Protein Length | Partial |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 7.2 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Pro-epidermal growth factor; Epidermal growth factor;EGF
Similar Products
−Mouse Milk Fat Globule EGF Factor 8 (MFGE8) ELISA Kit [orb775244]
Mouse
15.63-1000 pg/mL
6 pg/mL
96 T, 48 TMouse Tyrosine Kinase with Immunoglobulin Like and EGF Like Domains Protein 1 (Tie1) ELISA Kit [orb776387]
Mouse
0.63-40 ng/mL
0.266 ng/mL
96 T, 48 T

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Mouse Egf protein (orb594763)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review









