Cart summary

You have no items in your shopping cart.

TGFB2 Rabbit Polyclonal Antibody

SKU: orb579467

Description

Rabbit polyclonal antibody to TGFB2

Research Area

Cancer Biology, Cell Biology, Neuroscience, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Sheep, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human TGFB2
TargetTGFB2
Protein SequenceSynthetic peptide located within the following region: NLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKT
Molecular Weight46kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

LDS4, G-TSF, TGF-beta2

Similar Products

  • TGF Beta 1+2+3 Rabbit Polyclonal Antibody [orb7086]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Guinea pig, Porcine, Sheep

    Human, Mouse, Rabbit, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • TGF beta 2 Rabbit Polyclonal Antibody [orb500662]

    WB

    Mouse, Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 200 μl, 50 μl
  • TGF beta 2 Propeptide Rabbit Polyclonal Antibody [orb11469]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Rabbit, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • TGFB2 Specific Rabbit Polyclonal Antibody [orb395672]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • TGF beta 2 Antibody [orb1311963]

    WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

TGFB2 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Small Intestine, Antibody dilution: 1 ug/ml.

TGFB2 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Small Intestine, Antibody dilution: 1 ug/ml.

TGFB2 Rabbit Polyclonal Antibody

Positive control (+): THP-1 (N30), Negative control (-): U937 (N31), Antibody concentration: 3 ug/ml.

TGFB2 Rabbit Polyclonal Antibody

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

TGFB2 Rabbit Polyclonal Antibody

WB Suggested Anti-TGFB2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: NCI-H226 cell lysate. There is BioGPS gene expression data showing that TGFB2 is expressed in NCIH226.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_003229

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

TGFB2 Rabbit Polyclonal Antibody (orb579467)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry