Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Aβ1-40 Peptide

SKU: orb86006

Description

This product is Aβ1-40 Peptide. Its protein sequence is DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV. It targets Amyloid-beta precursor protein. Purification is performed using HPLC.

Research Area

DNA / RNA Binding, DNA and RNA Research, RNA Processing

Images & Validation

Key Properties

TargetAmyloid-beta precursor protein
PurificationHPLC
Protein SequenceDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

Storage & Handling

StorageShipped at 4°C. Stored at -20°C for one year. Avoid repeated freeze/thaw cycles.
Form/AppearanceLyophilized
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

β-Amyloid 1-40; beta Amyloid(1-40); beta-Amyloid 1-40; beta-Amyloid 1-40; Amyloid 1-40; A4; AAA; ABETA; ABPP; AD1; Alzheimers Disease Amyloid Protein; Amyloid B; Amyloid Beta A4 Protein Precursor; Amyloid Beta; Amyloid of Aging and Alzheimer Disease; APP; APPI; B Amyloid; Beta APP; Cerebral Vascular Amyloid Peptide; CTFgamma; CVAP; PN II; PN2; PreA4; Protease nexin II; A beta; A4_HUMAN.

Similar Products

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Available Sizes

Select a size below

100 μg
$ 150.00
500 μg
$ 370.00
1 mg
$ 490.00
DispatchUsually dispatched within 1-2 weeks.
Bulk Enquiry