Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

ABCB1 Rabbit Polyclonal Antibody

SKU: orb581349

Description

ABCB1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of ABCB1. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human ABCB1. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Immunology & Inflammation

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ABCB1
TargetABCB1
Protein SequenceSynthetic peptide located within the following region: AIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEAIENFRTVVSLTQ
Molecular Weight141kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

CLCS, MDR1, P-GP, PGY1, ABC20, CD243, GP170, p-170

Similar Products

  • MDR1 Rabbit Polyclonal Antibody [orb11267]

    ELISA,  ICC,  IF,  IHC-P

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • MDR1/P Glycoprotein Rabbit Polyclonal Antibody [orb11034]

    FC,  ICC,  WB

    Mouse

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • MDR1 Rabbit Polyclonal Antibody [orb221459]

    IF,  IHC-Fr,  IHC-P,  WB

    Mouse, Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • MDR1 Rabbit Polyclonal Antibody [orb340143]

    ELISA,  IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • P Glycoprotein/ABCB1 Rabbit Polyclonal Antibody [orb234261]

    IHC

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

ABCB1 Rabbit Polyclonal Antibody

Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 1 ug/ml.

ABCB1 Rabbit Polyclonal Antibody

Sample Tissue: Human K562 Whole Cell, Antibody dilution: 5 ug/ml.

ABCB1 Rabbit Polyclonal Antibody

Sample Tissue: Human Lung Tumor, Antibody dilution: 1 ug/ml.

ABCB1 Rabbit Polyclonal Antibody

Positive control (+): Rat Liver (R-LI), Negative control (-): Rat Testis (R-TE), Antibody concentration: 1 ug/ml.

ABCB1 Rabbit Polyclonal Antibody

Immunohistochemistry with Human Adrenal tissue.

ABCB1 Rabbit Polyclonal Antibody

Immunohistochemistry with Human Placenta tissue.

ABCB1 Rabbit Polyclonal Antibody

WB Suggested Anti-ABCB1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: NCI-H226 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_000918

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

ABCB1 Rabbit Polyclonal Antibody (orb581349)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry