ADIPOR1 Rabbit Polyclonal Antibody

SKU: orb585607

Description

Rabbit polyclonal antibody to ADIPOR1

Research Area

Cell Biology, Epigenetics & Chromatin, Molecular Biology, Stem Cell & Developmental Biology

Images & Validation

−

Item 1 of 4

Tested Applications	IHC, WB
Reactivity	Human, Mouse
Predicted Reactivity	Bovine, Canine, Equine, Goat, Guinea pig, Rat, Zebrafish

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Target	ADIPOR1
Protein Sequence	Synthetic peptide located within the following region: FPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDTLL
Molecular Weight	41 kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

CGI45, PAQR1, ACDCR1, CGI-45, TESBP1A

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml.

Rabbit Anti-ADIPOR1 Antibody, Catalog Number: orb585607, Formalin Fixed Paraffin Embedded Tissue: Human Thyroid Tissue, Observed Staining: Plasma membrane and cytoplasm in follicular cells, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-ADIPOR1 Antibody, Titration: 1.0 ug/ml, Positive Control: MDA-MB-435S Whole Cell. ADIPOR1 is supported by BioGPS gene expression data to be expressed in MDA-MB435.

Quick Database Links

Gene Symbol

ADIPOR1

UniProt

Q96A54

RefSeq (Protein):NP_057083

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_057083

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

IHC

Immunohistochemistry

View Protocol

Find More Protocols