BAK1 Rabbit Polyclonal Antibody

SKU: orb329573

Description

BAK1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody targeting BAK1. It is suitable for WB and is reactive with human samples. Predicted reactivity includes Equine. This antibody is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

−

Item 1 of 2

Tested Applications	WB
Reactivity	Human
Predicted Reactivity	Equine

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Target	BAK1
Protein Sequence	Synthetic peptide located within the following region: ASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEG
Molecular Weight	23kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

anti BAK antibody, anti BAK-LIKE antibody, anti BCL2L7 antibody, anti CDN1 antibody, anti MGC117255 antibody, anti MGC3887 antibody

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Rabbit Anti-BAK1 Antibody, Catalog Number: orb329573, Formalin Fixed Paraffin Embedded Tissue: Human Lymph Node Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.

WB Suggested Anti-BAK1 Antibody, Titration: 1.0 ug/mL, Positive Control: Fetal Heart.

Quick Database Links

Gene Symbol

BAK1

UniProt

Q16611

RefSeq (Protein):NP_001179

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_001179

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols