CLEC4M Rabbit Polyclonal Antibody

SKU: orb325006

Description

CLEC4M Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of CLEC4M. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human CLEC4M. This antibody reacts with Human samples and is predicted to react with Mouse, Porcine, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Disease Biomarkers, Immunology & Inflammation, Molecular Biology, Protein Biochemistry

Images & Validation

−

Item 1 of 1

Tested Applications	WB
Reactivity	Human
Predicted Reactivity	Mouse, Porcine, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human CLEC4M
Target	CLEC4M
Protein Sequence	Synthetic peptide located within the following region: NRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFS
Molecular Weight	45kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

anti CD209L antibody, anti CD299 antibody, anti DC-SIGN2 antibody, anti DC-SIGNR antibody, anti DCSIGNR antibody, anti HP10347 antibody, anti L-SIGN antibody, anti LSIGN antibody, anti MGC129964 antibody, anti MGC47866 antibody

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

WB Suggested Anti-CLEC4M Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: Human kidney.

Quick Database Links

Gene Symbol

CLEC4M

UniProt

Q9H2X3

RefSeq (Protein):NP_055072

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_055072

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols