Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

COL1A1 Rabbit Polyclonal Antibody

SKU: orb331080

Description

COL1A1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of COL1A1. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the C terminal region of human COL1A1. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Musculoskeletal & Connective Tissue Research

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human COL1A1
TargetCOL1A1
Protein SequenceSynthetic peptide located within the following region: YRADDANVVRDRDLEVDTTLKSLSQQIENIRSPEGSRKNPARTCRDLKMC
Molecular Weight137kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Anti-CO1A1_HUMAN antibody, anti-Collagen I antibody, anti-COL1A1 antibody, anti-COL1A2 antibody, anti-Collagen type I alpha 1 antibody, anti-Collagen type I alpha 2 antibody

Similar Products

  • Collagen I Rabbit Polyclonal Antibody [orb312178]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Gallus, Sheep

    Human, Mouse, Rabbit, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • Collagen I/COL1A1 Rabbit Polyclonal Antibody [orb371672]

    IF,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • Collagen I/COL1A1 Rabbit Polyclonal Antibody [orb107158]

    ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • COL1A1 Rabbit Polyclonal Antibody [orb1294293]

    IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    25 μl, 100 μl
  • Collagen 1, alpha 1 telopeptide Antibody [orb319485]

    ELISA,  IHC,  WB

    Aves, Bovine, Canine, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Primate, Rabbit, Rodent, Xenopus

    Human, Mouse, Rat, Sheep

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

COL1A1 Rabbit Polyclonal Antibody

Rabbit Anti-COL1A1 Antibody, Catalog Number: orb331080, Formalin Fixed Paraffin Embedded Tissue: Human Urinary Bladder Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

COL1A1 Rabbit Polyclonal Antibody

WB Suggested Anti-COL1A1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human brain.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_000079

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

COL1A1 Rabbit Polyclonal Antibody (orb331080)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry