Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

DCST1 Rabbit Polyclonal Antibody

SKU: orb578825

Description

DCST1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of DCST1. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the C terminal region of human DCST1. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Immunology & Inflammation

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human DCST1
TargetDCST1
Protein SequenceSynthetic peptide located within the following region: SYVCRTLDCEAVYCWSCWDDMRQRCPVCTPREELSSSAFSDSNDDTAYAG
Molecular Weight81 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

FLJ32785, RP11-307C12.10

Similar Products

  • DCST1 Rabbit Polyclonal Antibody [orb2242]

    ELISA,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat, Sheep

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • DCST1 Rabbit Polyclonal Antibody (HRP) [orb481316]

    ELISA,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat, Sheep

    Rabbit

    Polyclonal

    HRP

    100 μl
  • DCST1 Rabbit Polyclonal Antibody (PE-Cy7) [orb881919]

    ICC,  IF

    Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat, Sheep

    Rabbit

    Polyclonal

    PE/Cy7

    100 μl
  • DCST1 Rabbit Polyclonal Antibody (PE-Cy5.5) [orb882248]

    ICC,  IF

    Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat, Sheep

    Rabbit

    Polyclonal

    PE/Cy5.5

    100 μl
  • DCST1 Rabbit Polyclonal Antibody (APC) [orb992796]

    ICC,  IF

    Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat, Sheep

    Rabbit

    Polyclonal

    APC

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

DCST1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Canonical isoform is 81 kDa and can be glycosylated. Also recognizes a potential ~58 kDa isoform.

DCST1 Rabbit Polyclonal Antibody

Immunohistochemistry with Human Heart lysate tissue at an antibody concentration of 5.0 ug/ml using anti-DCST1 antibody (orb578825).

DCST1 Rabbit Polyclonal Antibody

WB Suggested Anti-DCST1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_689707

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

DCST1 Rabbit Polyclonal Antibody (orb578825)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry