HSPA1L Rabbit Polyclonal Antibody

SKU: orb582161

Description

HSPA1L Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of HSPA1L. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the C terminal region of human HSPA1L. This antibody reacts with Human, Rat samples and is predicted to react with Bovine, Canine, Equine, Goat, Mouse, Porcine. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Images & Validation

−

Item 1 of 6

Tested Applications	WB
Reactivity	Human, Rat
Predicted Reactivity	Bovine, Canine, Equine, Goat, Mouse, Porcine

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the C terminal region of human HSPA1L
Target	HSPA1L
Protein Sequence	Synthetic peptide located within the following region: DEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD
Molecular Weight	70kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

HSP70T, hum70t, HSP70-1L, HSP70-HOM

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links

Gene Symbol

HSPA1L

UniProt

P34931

RefSeq (Protein):NP_005518

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_005518

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols

Applications:	ELISA, FC, ICC, IF, IHC, WB
Reactivity:	Human, Mouse, Rat
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	Unconjugated

Applications:	ELISA, IF, IHC, WB
Reactivity:	Human, Mouse, Rat
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	Unconjugated

Applications:	ELISA, IHC, WB
Reactivity:	Human, Mouse, Rat
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	Unconjugated

Applications:	IHC, WB
Reactivity:	Bovine, Canine, Human, Monkey, Mouse, Porcine, Rat
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	Unconjugated

Applications:	WB
Reactivity:	Human
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	Unconjugated