KLF2 Rabbit Polyclonal Antibody

SKU: orb577025

Description

KLF2 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of KLF2. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human KLF2. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cancer Biology

Images & Validation

−

Item 1 of 3

Tested Applications	WB
Reactivity	Human, Mouse
Predicted Reactivity	Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human KLF2
Target	KLF2
Protein Sequence	Synthetic peptide located within the following region: NWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALHMKRH
Molecular Weight	37kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

LKLF

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links

Gene Symbol

KLF2

UniProt

Q9Y5W3

RefSeq (Protein):NP_057354

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_057354

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols

Applications:	ELISA, ICC, IF, IHC-P, WB
Reactivity:	Bovine, Equine, Human, Mouse, Porcine, Rat, Sheep
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	Unconjugated

Applications:	ChIP, IHC, WB
Predicted Reactivity:	Guinea pig, Mouse, Porcine, Rat, Zebrafish
Reactivity:	Human
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	Unconjugated

Applications:	FC, IF, IHC-Fr, IHC-P, WB
Predicted Reactivity:	Bovine, Equine, Porcine, Rabbit, Sheep
Reactivity:	Human, Mouse, Rat
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	Unconjugated

Applications:	FC, IF
Predicted Reactivity:	Bovine, Equine, Porcine, Rabbit, Sheep
Reactivity:	Human, Mouse, Rat
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	PE