Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Nfe2l2 Rabbit Polyclonal Antibody

SKU: orb324680

Description

Nfe2l2 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of Nfe2l2. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Nfe2l2. This antibody reacts with Human, Rat samples and is predicted to react with Bovine, Canine, Mouse, Rabbit, Yeast. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cancer Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Rat
Predicted ReactivityBovine, Canine, Mouse, Rabbit, Yeast

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Rat Nfe2l2
TargetNfe2l2
Protein SequenceSynthetic peptide located within the following region: DLIDILWRQDIDLGVSREVFDFSQRQKDYELEKQKKLEKERQEQLQKEQE
Molecular Weight65kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Similar Products

  • Nrf2 Rabbit Polyclonal Antibody [orb11165]

    ICC,  IF,  IHC-P,  WB

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • NFE2L2 Rabbit Polyclonal Antibody [orb1294327]

    IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 25 μl
  • Phospho-Nrf2 (Ser40) Rabbit Polyclonal Antibody [orb6544]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Gallus, Mouse, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Nrf2 Rabbit Polyclonal Antibody [orb500793]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Human, Mouse, Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Nrf2 Polyclonal Antibody [orb1411433]

    IF,  IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Nfe2l2 Rabbit Polyclonal Antibody

Sample Type: Rat Thymus lysates, Antibody Dilution: 1.0 ug/mL.

Nfe2l2 Rabbit Polyclonal Antibody

Sample Tissue: Rat Skeletal Muscle, Antibody Dilution: 1 ug/mL.

Nfe2l2 Rabbit Polyclonal Antibody

Rabbit Anti-NFE2L2 Antibody, Catalog Number: orb324680, Formalin Fixed Paraffin Embedded Tissue: Human Urinary Bladder Tissue, Observed Staining: Cytoplasm, Nucleus, Primary Antibody Concentration: 1:600, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_113977

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

Nfe2l2 Rabbit Polyclonal Antibody (orb324680)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry