You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using M-NFS-60 mouse lymphoblast cells is 0.01 ng/ml. |
| Tag | Tag-Free |
| Expression Region | 23-140aa |
| Protein Length | Partial |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 13.4 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | HGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered solution of 20mM PB, 300mM NaCl, 5% Trehalose, pH 6.5. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Mouse IL4 protein [orb594837]
Greater than 95% as determined by SDS-PAGE.
14.6 kDa
Mammalian cell
50 μg, 10 μg, 1 mg, 500 μgMouse IL4 protein (Active) [orb359010]
> 97% as determined by SDS-PAGE and HPLC.
13.5 kDa
E.Coli
500 μg, 100 μg, 5 μgRecombinant Human IL-4 RA Protein [orb2994735]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 50.2 KDa. Observed: 65-86 KDa, reducing conditions
50 μg, 500 μg, 1 mg, 10 μgRecombinant Mouse IL-4RA Protein [orb2994779]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 51.5 KDa. Observed: 65-80 KDa, reducing conditions
50 μg, 500 μg, 1 mg, 10 μgRecombinant Mouse IL-4RA Protein [orb2993732]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 25.2 KDa. Observed: 32-45 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.



