You have no items in your shopping cart.
Recombinant Human Leukemia inhibitory factor (LIF) (Active)
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized human LIF at 2 μg/ml can bind human LIFR, the EC50 is 22.58-30.24 ng/ml. |
| Tag | C-terminal hFc1-tagged |
| Expression Region | 23-202aa |
| Protein Length | Full Length of Mature Protein |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 48.6 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−Recombinant Human Leukemia inhibitory factor (LIF) (Active) [orb1785348]
Greater than 95% as determined by SDS-PAGE.
23.1 kDa
Mammalian cell
100 μg, 20 μg, 1 mgRecombinantOSM,Rat [orb1494781]
> 95% as analyzed by SDS-PAGE and HPLC.
24.5 kDa, observed by reducing SDS-PAGE.
Escherichia coli.
1 mg, 10 μg, 50 μgRecombinantOSM,Mouse [orb1494782]
> 95% as analyzed by SDS-PAGE and HPLC.
20.5 kDa, observed by reducing SDS-PAGE.
Escherichia coli.
1 mg, 10 μg, 50 μgRecombinantOSM(209aa),Human [orb1494784]
> 95% as analyzed by SDS-PAGE and HPLC.
23.8 kDa, observed by reducing SDS-PAGE.
Escherichia coli.
50 μg, 1 mg, 10 μgRecombinant human LIF protein (Active, CHO) [orb2978607]
≥ 95% as determined by SDS-PAGE.
19.7 kDa
10 μg, 50 μg, 500 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.




