Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Recombinant Mouse APRIL

SKU: orb623193

Description

A proliferation-inducing ligand (APRIL), also known as TNFSF13, is a member of the tumor necrosis factor (TNF) ligand superfamily. APRIL/TNFSF13 has been shown to play a role in protecting cells from undergoing apoptosis and promoting B cell development. Mouse APRIL Recombinant Protein is purified APRIL (TNFSF13) produced in yeast.

Images & Validation

Application Notes
The Mouse VEGF-A protein can be used in cell culture, as a VEGF-A ELISA Standard, and as a Western Blot Control.

Key Properties

SourceYeast
MW16.4 kDa
Protein SequenceAVLTQKHKKKHSVLHLVPVNITSKADSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYL LYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDI ITVKIPRANAKLSLSPHGTFLGFVKL (146)

Storage & Handling

Storage-20°C
Form/AppearanceLyophilized
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Similar Products

  • Recombinant Mouse APRIL Protein [orb2994771]

    Unconjugated

    SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.

    Predicted: 42.7 KDa. Observed: 50-60 KDa, reducing conditions

    10 μg, 50 μg, 500 μg, 1 mg
  • Recombinant Human B Cell Activating Factor (rHuBAFF) [orb1494994]

    >95% by SDS-PAGE and HPLC analyses.

    Approximately 17.0 kDa, a single non-glycosylated polypeptide chain containing 153 amino acids.

    Escherichia coli.

    1 mg, 5 μg, 20 μg
  • RecombinantApril,Mouse [orb1494906]

    > 95% by SDS-PAGE and HPLC analyses

    21.9kDa, observed by reducing SDS-PAGE.

    Escherichia coli.

    1 mg, 10 μg, 50 μg
  • Mouse APRIL protein [orb1216262]

    98%

    16.4 kDa

    Yeast

    5 μg, 25 μg, 100 μg, 500 μg
  • Functional APRIL (mouse) Antibody, mAb (recombinant) (blocking) (Biotin) [orb1788531]

    ELISA,  IP

    Mouse

    Monoclonal

    Unconjugated

    100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Available Sizes

Select a size below

5 μg
$ 410.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry