Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Recombinant Mouse TNF alpha

SKU: orb623196

Description

Tumor necrosis factor alpha (TNFSF2, TNF alpha) is a member of the TNF Superfamily. TNF alpha, being an endogenous pyrogen, is able to induce fever, to induce apoptotic cell death, to induce sepsis (through IL-1 & IL-6 production), to induce cachexia, induce inflammation, and to inhibit tumorigenesis and viral replication. Mouse TNF alpha Recombinant Protein is purified TNF alpha (TNFSF2) produced in yeast.

Research Area

Immunology & Inflammation

Images & Validation

Application Notes
The Mouse IL-6 protein can be used in cell culture, as an IL-6 ELISA Standard, and as a Western Blot Control.

Key Properties

SourceYeast
MW17.3 kDa
Protein SequenceLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYS QVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLG GVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL (156)

Storage & Handling

Storage-20°C
Form/AppearanceLyophilized
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Similar Products

  • Recombinant Human TNF RII Protein [orb2994890]

    Unconjugated

    SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.

    Predicted: 46.44 KDa. Observed: 60 KDa, reducing conditions

    10 μg, 50 μg, 500 μg, 1 mg
  • TNF α Rabbit pAb Antibody [orb763767]

    IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • CD156b Mouse Monoclonal Antibody [orb2988583]

    FC,  IF,  WB

    Human, Mouse

    Mouse

    Monoclonal

    Unconjugated

    200 μl, 100 μl, 50 μl, 30 μl
  • TNF alpha Mouse Monoclonal Antibody [orb323199]

    IF,  IHC,  WB

    Human, Mouse, Rat

    Mouse

    Monoclonal

    Unconjugated

    30 μl, 100 μl, 200 μl, 50 μl
  • Recombinant Mouse Tumor necrosis factor (Tnf), partial (Active) [orb2992185]

    Greater than 95% as determined by SDS-PAGE.

    18.7 kDa

    Mammalian cell

    1 mg, 100 μg, 20 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Available Sizes

Select a size below

5 μg
$ 410.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry