You have no items in your shopping cart.
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | CHO |
|---|---|
| Biological Activity | ED50 < 5 pg/ml, measured in a proliferation assay using D10S cells. |
| Purification | > 95% as analyzed by SDS-PAGE. |
| Endotoxins | < 0.2 EU/μg, determined by LAL method. |
| MW | 17~22 kDa, observed by reducing SDS-PAGE. |
| Purity | > 95% as analyzed by SDS-PAGE. |
| Protein Sequence | APHSFQNNLRYKLIRIVKQEFIMNDSLNQNIYVDMDRIHLKAASLNDLQLEVKFDMYAYSSGGDDSKYPVTLKVSNTQLF VSAQGEDKPVLLKEIPETPKLITGSETDLIFFWEKINSKNYFTSAAFPELLIATKEQSQVHLARGLPSMIDFQIS |
Storage & Handling
−| Storage | Lyophilized recombinant Rat Interleukin-1 alpha remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Rat Interleukin-1 alpha should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
|---|---|
| Form/Appearance | Lyophilized after extensive dialysis against PBS. |
| Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Interleukin-1α, IL1α; Hematopoietin-1, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF)

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide