Rel Rabbit Polyclonal Antibody

SKU: orb329896

Description

Rabbit polyclonal antibody to Rel

Research Area

Cancer Biology

Images & Validation

−

Item 1 of 3

Tested Applications	WB
Reactivity	Human, Mouse
Predicted Reactivity	Bovine, Canine, Equine, Guinea pig, Rabbit, Rat

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide corresponding to a region of Mouse
Target	Rel
Protein Sequence	Synthetic peptide located within the following region: KAILEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDAYGNKSKKQKTTLIF
Molecular Weight	65kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

anti c-Rel antibody

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Rabbit Anti-REL Antibody, Catalog Number: orb329896, Formalin Fixed Paraffin Embedded Tissue: Human Bone Marrow Tissue, Observed Staining: Nucleus, Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.

WB Suggested Anti-REL Antibody, Positive Control: Lane 1: 100 ug mouse liver, Lane 2: 100 ug mouse brain, Lane 3: 100 ug mouse heart, Lane 4: 100 ug mouse kidney, Lane 5: 100 ug mouse lung, Lane 6: 100 ug mouse thymus, Lane 7: 100 ug mouse spleen, Lane 8: 100 ug mouse testis, Lane 9: 100 ug mouse HeLa, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-AP, Secondry Antibody Dilution: 1:10000.

WB Suggested Anti-Rel Antibody Titration: 0.2-1 ug/mL, Positive Control: Mouse Lung.

Quick Database Links

Gene Symbol

Rel

UniProt

A4QPD3

RefSeq (Protein):NP_033070

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_033070

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols