STAT3 Rabbit Polyclonal Antibody

SKU: orb592766

Description

Rabbit polyclonal antibody to STAT3

Research Area

Cancer Biology, Cell Biology, Epigenetics & Chromatin, Immunology & Inflammation, Neuroscience, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

−

Item 1 of 6

Tested Applications	IHC, WB
Reactivity	Human
Predicted Reactivity	Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human STAT3
Target	STAT3
Protein Sequence	Synthetic peptide located within the following region: FGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTIDLPMSPRTLD
Molecular Weight	88kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

APRF, HIES, ADMIO, ADMIO1

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The peptide is also present in a 83 kDa isoform.The protein may be modified by acetylation and phosphorylation.

Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 3 ug/ml.

Human Uterus

Immunohistochemistry with Thymus tissue at an antibody concentration of 5.0 ug/ml using anti-STAT3 antibody (orb592766).

WB Suggested Anti-STAT3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: 721_B cell lysate. STAT3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

Quick Database Links

Gene Symbol

STAT3

UniProt

P40763

RefSeq (Protein):NP_644805

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_644805

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

IHC

Immunohistochemistry

View Protocol

Find More Protocols