Synapsin-1 Antibody

SKU: orb3092046

Description

Anti-SARS-CoV-2 NSP9 Antibody. Tested in ELISA applications. This antibody reacts with Human.

Images & Validation

−

Tested Applications	ELISA
Reactivity	Human
Application Notes	ELISA, 0.001-0.1μg/ml, Human. Add 0.2ml of distilled water will yield a concentration of 500ug/ml

Key Properties

−

Antibody Type	Primary Antibody
Host	Rabbit
Clonality	Polyclonal
Isotype	Rabbit IgG
Immunogen	NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ
Target	Synapsin-1
Molecular Weight	140 kDa, 130 kDa, 110 kDa
Purification	Immunogen affinity purified.
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Form/Appearance	Lyophilized
Concentration	Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Disclaimer	For research use only

Alternative Names

−

Replicase polyprotein 1ab; pp1ab; ORF1ab polyprotein; nsp9; Non-structural protein 9

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links

Gene Symbol

Synapsin-1

UniProt

P0DTD1, P0DTC1

UniProt Details

−

No UniProt data available

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

ELISA

Enzyme-linked Immunosorbent Assay (EIA)

View Protocol

Find More Protocols