Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Tat-beclin 1

SKU: orb1140642

Description

Autophagy inducing peptide; Cell penetrating peptides.

Research Area

Signal Transduction

Images & Validation

Key Properties

CAS Number1423821-88-8
MW3741.15 Da
Purity> 95% by hplc
FormulaC164H251N57O45
Protein SequenceH-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Thr-Asn-Val-Phe-Asn-Ala-Thr-Phe-Glu-Ile-Trp-His-Asp-Gly-Glu-Phe-Gly-Thr-OH

Storage & Handling

StorageStore dry, frozen and in the dark
Form/AppearanceFreeze dried solid
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

1423821-88-8, Beclin-1 Activator ITat-BECN1, Tat-Beclin 1, YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT, beclin 1 peptide

Similar Products

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Tat-beclin 1 (orb1140642)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

1 mg
$ 290.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry