WDR5 Rabbit Polyclonal Antibody

SKU: orb577998

Description

Rabbit polyclonal antibody to WDR5

Research Area

Cell Biology, Epigenetics & Chromatin, Protein Biochemistry, Signal Transduction

Images & Validation

−

Item 1 of 4

Tested Applications	IHC, IP, WB
Reactivity	Human
Predicted Reactivity	Bovine, Canine, Equine, Guinea pig, Mouse, Rat, Yeast, Zebrafish

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the C terminal region of human WDR5
Target	WDR5
Protein Sequence	Synthetic peptide located within the following region: LAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGI
Molecular Weight	36kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

SWD3, BIG-3, CFAP89

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Amount and Sample Type: 500 ug Human NT2 cell lysate, Amount of IP Antibody: 6 ug, Primary Antibody: WDR5, Primary Antibody Dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody Dilution: 1:5000, Gene Name: WDR5.

Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 2 ug/ml.

Sample Type: Human brain stem cells (NT2), Primary Antibody Dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa Fluor 594, Secondary Antibody Dilution: 1:1000, Color/Signal Descriptions: Red: WDR5 Blue: DAPI, Gene Name: WDR5.

WB Suggested Anti-WDR5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 721_B cell lysate.

Quick Database Links

Gene Symbol

WDR5

UniProt

Q5M786

RefSeq (Protein):NP_060058

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_060058

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

IHC

Immunohistochemistry

View Protocol

Immunoprecipitation

View Protocol

Find More Protocols