Cart summary

You have no items in your shopping cart.

ABCC9 Rabbit Polyclonal Antibody

SKU: orb330328

Description

Rabbit polyclonal antibody to ABCC9

Research Area

Cell Biology, Molecular Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ABCC9
TargetABCC9
Protein SequenceSynthetic peptide located within the following region: AVVTEGGENFSVGQRQLFCLARAFVRKSSILIMDEATASIDMATENILQK
Molecular Weight174kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti ABC37 antibody, anti CMD1O antibody, anti FLJ36852 antibody, anti SUR2 antibody, anti ATFB12 antibody

Similar Products

  • ABCC9 Rabbit Polyclonal Antibody (Biotin) [orb452513]

    WB

    Canine, Equine, Human, Porcine, Sheep

    Mouse, Rat

    Rabbit

    Polyclonal

    Biotin

    100 μl
  • ABCC9 Rabbit Polyclonal Antibody [orb317546]

    WB

    Canine, Equine, Human, Porcine, Sheep

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • ABCC9 rabbit pAb Antibody [orb772306]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • ABCC9 Antibody (Center) [orb165389]

    WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    80 μl
  • ABCC9 Antibody [orb3072505]

    WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 200 μl, 100 μl, 30 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

ABCC9 Rabbit Polyclonal Antibody

Sample Tissue: Human PANC1, Antibody Dilution: 1.0 ug/mL.

ABCC9 Rabbit Polyclonal Antibody

Lanes: 1: 10 ug SUR1 KO mouse ventricle lysate, 2: 10 ug WT mouse ventricle lysate, 3: 0.1 ug SUR1 overexpressing mouse ventricle lysate, 4: 10 ug cannine ventricle lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody Dilution: 1:2000, Gene Name: ABCC9.

ABCC9 Rabbit Polyclonal Antibody

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

ABCC9 Rabbit Polyclonal Antibody

WB Suggested Anti-ABCC9 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: 721_B cell lysate, ABCC9 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_005682

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

ABCC9 Rabbit Polyclonal Antibody (orb330328)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry