You have no items in your shopping cart.
BNP-32, human
SKU: orb2694961
Description
Images & Validation
−
Key Properties
−| Target | Natriuretic Peptide |
|---|---|
| Molecular Weight | 3464.1 |
| Protein Sequence | SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26) |
| Purity | ≥95% |
Storage & Handling
−| Disclaimer | For research use only |
|---|
Similar Products
−Human Natriuretic Peptide precursor B (NPPB) ELISA Kit [orb1146950]
Human
1.57-100 ng/mL
0.56 ng/mL
96 T, 48 THuman N-Terminal Pro-Brain Natriuretic Peptide (NT-ProBNP) EasyStep ELISA Kit [orb1950025]
Human
0.94-60 ng/mL
0.94 ng/mL
48 T, 96 T

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
Gene Symbol
Natriuretic Peptide
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
BNP-32, human (orb2694961)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review







