Cart summary

You have no items in your shopping cart.

C4orf28 Rabbit Polyclonal Antibody (FITC)

SKU: orb2108733

Description

C4orf28 Rabbit Polyclonal Antibody (FITC)

Images & Validation

Tested ApplicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human C4orf28
Protein SequenceSynthetic peptide located within the following region: PPESLSFDPLLITLAEGLRETKHPYTFVSKEGFRELLLVKGAPEKAIPLL
Molecular Weight24kDa
PurificationAffinity Purified
ConjugationFITC

Storage & Handling

StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

C4orf28

Similar Products

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_659485

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

C4orf28 Rabbit Polyclonal Antibody (FITC) (orb2108733)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet