You have no items in your shopping cart.
Dog CGRP protein
SKU: orb358731
Featured
Description
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Canis lupus familiaris (Dog) (Canis familiaris) |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Molecular Weight | 19.4 kDa |
| Expression Region | 85-116aa |
| Protein Length | Partial |
| Protein Sequence | CSNLSTCVLGTYSKDLNNFHTFSGIGFGAETP |
| Purity | Greater than 90% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Disclaimer | For research use only |
Alternative Names
−Alpha type CGRP protein, Beta type CGRP protein, CALC 1 protein, CALC A protein, CALC1 protein, CALC2 protein, CALCA protein, CALCB protein, Calcitonin 1 protein, Calcitonin 2 protein, CGRP protein, CGRP-I protein, CGRP I protein, CGRP-II protein, CGRP II protein, CGRP 1 protein, CGRP-1 protein, CGRP1 protein, CGRP 2 protein, CGRP-2 protein, CGRP2 protein, Katacalcin protein
Similar Products
−Dog CalcitoninGene Related Peptide 1 (CGRP1) ELISA Kit [orb779840]
Canine
15.63-1000 pg/mL
5.45 pg/mL
48 T, 96 TDog S100A12 ELISA Kit [orb403508]
Canine
0.625 ng/mL-40 ng/mL
0.156 ng/mL
10 x 96 T, 5 x 96 T, 96 T, 48 T, 24 T

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Dog CGRP protein (orb358731)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review
