You have no items in your shopping cart.
GLP-2 Antibody Blocking Peptide
SKU: orb72745
Description
Research Area
Cancer Research, Energy Metabolism, Hormone Research, Metabolism
Images & Validation
−
Key Properties
−| Target | Pro-glucagon |
|---|---|
| Protein Sequence | HADGSFSDEMNILDNLAADFINWLIQTKITD |
| Purification | HPLC |
Storage & Handling
−| Storage | Shipped at 4°C. Stored at -20°C for one year. Avoid repeated freeze/thaw cycles. |
|---|---|
| Form/Appearance | Lyophilized |
| Disclaimer | For research use only |
Alternative Names
−Glucagan-like petide; glp-2; GCG; Glicentin; Glicentin related polypeptide; GLP 2; Glucagon like peptide 2; Glucagon precursor; Glucagon preproprotein; GRPP; OXM; OXY; Oxyntomodulin; GLUC_HUMAN.
Similar Products
−
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
Gene Symbol
Pro-glucagon
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
GLP-2 Antibody Blocking Peptide (orb72745)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review