You have no items in your shopping cart.
GRN Rabbit Polyclonal Antibody
SKU: orb330767
Description
Research Area
Cancer Biology, Signal Transduction, Stem Cell & Developmental Biology
Images & Validation
−Item 1 of 5
| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Equine |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human GRN |
| Target | GRN |
| Protein Sequence | Synthetic peptide located within the following region: QAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQAL |
| Molecular Weight | 64 kDa |
| Purification | Affinity purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−anti GRN antibody, anti antibody
Similar Products
−- Item 1 of 4
GRN Rabbit Polyclonal Antibody [orb330766]
WB
Bovine, Canine, Equine, Rabbit
Human
Rabbit
Polyclonal
Unconjugated
100 μl - Item 1 of 1
Granulin Rabbit Polyclonal Antibody [orb11269]
IF, IHC-Fr, IHC-P
Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
Human
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl - Item 1 of 2
- Item 1 of 2
GRN Rabbit Polyclonal Antibody [orb2954445]
ELISA, IHC, WB
Human
Rabbit
Polyclonal
Unconjugated
100 μg, 50 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Canonical 62 kDa isoform is identified, and a second isoform of 52 kDa is also present in some samples.
50 ug of HEK293T WT and GRN KO lysates were subjected to SDS-PAGE followed by immunoblotting with an antibody dilution of 1/5000. The second image shows Ponceau S staining of the transferred blot as a loading control experiment.
Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 3 ug/ml.
Sample Type: 721_B Whole Cell lysates, Antibody dilution: 1.0 ug/ml.
Immunoprecipitation was performed on concentrated culture media from Brefeldin A treated HEK293T cells using 1.0 μg of the antibody pre-coupled to either protein G or protein A magnetic beads. Samples were washed and processed for immunoblot with an alternate GRN antibody at 1/1000. The Ponceau stained transfers of each blot are shown. SM=10% starting material; UB=10% unbound fraction; IP=immunoprecipitate.
Quick Database Links
Gene Symbol
GRN
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
GRN Rabbit Polyclonal Antibody (orb330767)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 1 - 2 weeks