You have no items in your shopping cart.
Human IP 10 Protein
SKU: orb426655
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Escherichia Coli |
|---|---|
| Protein Sequence | VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKA IKNLLKAVSKERSKRSP |
| Purity | Greater than 95.0% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | Stability: Lyophilized IP-10 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CXCL10 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles |
|---|---|
| Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Buffer/Preservatives | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA). |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Small inducible cytokine B10, CXCL10, 10 kDa, Gamma-IP10, IP-10, chemokine (C-X-C motif) ligand 10, C7, IFI10, INP10, crg-2, mob-1, SCYB10, gIP-10.
Similar Products
−Human Chemokine C-X-C-Motif Receptor 3 (CXCR3) ELISA Kit [orb775386]
Human
0.16-10 ng/mL
0.059 ng/mL
96 T, 48 THuman Interferon Gamma Induced Protein 10kDa (IP-10/CXCL10) ELISA Kit [orb1807392]
Human
7.82-500pg/mL
3.1 pg/mL
48 T, 96 THuman CXL10 protein (Active) [orb359056]
> 97% as determined by SDS-PAGE and HPLC.
8.6 kDa
E.Coli
5 μg, 100 μg, 500 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human IP 10 Protein (orb426655)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review







