Cart summary

You have no items in your shopping cart.

ISG15 Rabbit Polyclonal Antibody

SKU: orb584319

Description

Rabbit polyclonal antibody to ISG15

Research Area

Epigenetics, Immunology, Infectious Diseases

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Goat, Porcine, Rabbit, Sheep

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ISG15
TargetISG15
Protein SequenceSynthetic peptide located within the following region: EPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGK
Molecular Weight17kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

G1P2, IP17, UCRP, IFI15, IMD38, hUCRP

Similar Products

  • EFP rabbit pAb Antibody [orb770422]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • HECT E3 ubiquitin ligase Rabbit Polyclonal Antibody [orb157475]

    ICC,  IF,  IHC-Fr,  IHC-P

    Rat

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • ISG15 rabbit pAb Antibody [orb773893]

    ELISA,  IF,  IHC,  WB

    Human, Mouse

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • ISG15 Rabbit Polyclonal Antibody [orb371684]

    IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • ISG15 Rabbit Polyclonal Antibody [orb371685]

    IHC,  WB

    Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

ISG15 Rabbit Polyclonal Antibody

Sample Type: 1. Human NT-2 cells (60 ug), 2. mouse brain extracts (80 ug), Primary Antibody dilution: 2 ug/ml, Secondary Antibody: IRDye 800CW goat anti-rabbit, Secondary Antibody dilution: 1:20000.

ISG15 Rabbit Polyclonal Antibody
ISG15 Rabbit Polyclonal Antibody

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

ISG15 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

ISG15 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

ISG15 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

ISG15 Rabbit Polyclonal Antibody

Sample Type: Human Hela, Antibody dilution: 1.0 ug/ml. ISG15 is supported by BioGPS gene expression data to be expressed in HeLa.

ISG15 Rabbit Polyclonal Antibody

Sample Type: Human MCF7, Antibody dilution: 1.0 ug/ml. ISG15 is supported by BioGPS gene expression data to be expressed in MCF7.

ISG15 Rabbit Polyclonal Antibody

Application: IHC, Species+tissue/cell type: Mouse brain stem cells, Primary antibody dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary antibody dilution: 1:1000.

ISG15 Rabbit Polyclonal Antibody

WB Suggested Anti-ISG15 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human kidney.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_005092

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

ISG15 Rabbit Polyclonal Antibody (orb584319)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry