Cart summary

You have no items in your shopping cart.

MAPKAPK2 Rabbit Polyclonal Antibody

SKU: orb331093

Description

Rabbit polyclonal antibody to MAPKAPK2

Research Area

Cell Biology, Molecular Biology, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human MAPKAPK2
TargetMAPKAPK2
Protein SequenceSynthetic peptide located within the following region: KLTDFGFAKETTQNALQTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMY
Molecular Weight42kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti 3PK antibody, anti MAPKAP3 antibody, anti MK2 antibody, anti MK-2 antibody, anti MAPKAP-K2 antibody

Similar Products

  • MAPKAPK2 Antibody (N-term) [orb693482]

    IHC-P,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • MAPKAPK-2 (phospho Thr334) rabbit pAb Antibody [orb770878]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • MAPKAPK-2 (phospho Thr222) rabbit pAb Antibody [orb770879]

    ELISA,  IF,  IHC,  WB

    Human, Monkey, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • MAPKAPK-2 rabbit pAb Antibody [orb770882]

    ELISA,  IF,  IHC,  WB

    Human, Monkey, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • Phospho-MAPKAPK2 (Thr222) Rabbit Polyclonal Antibody [orb6383]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Human, Monkey, Rabbit

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

MAPKAPK2 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Skeletal Muscle, Antibody dilution: 1 ug/ml.

MAPKAPK2 Rabbit Polyclonal Antibody

Rabbit Anti-MAPKAPK2 Antibody, Catalog Number: orb331093, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

MAPKAPK2 Rabbit Polyclonal Antibody

WB Suggested Anti-MAPKAPK2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_004626

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

MAPKAPK2 Rabbit Polyclonal Antibody (orb331093)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry