You have no items in your shopping cart.
Mouse Tnfrsf10b protein
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Biological Activity | The ED50 as determined by its ability to inhibit TRAIL-mediated cytotoxicity using L-929 mouse fibroblast cells treated with TRAIL is 92.04 ng/ml in the presence of 40 ng/mL of TNFSF10. |
| Tag | C-terminal Fc-tagged |
| Molecular Weight | 40.9 kDa |
| Expression Region | 53-177aa |
| Protein Length | Partial |
| Protein Sequence | NPAHNRPAGLQRPEESPSRGPCLAGQYLSEGNCKPCREGIDYTSHSNHSLDSCILCTVCKEDKVVETRCNITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEELTSCTPRENRKCVSKTAWAS |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−TNFRSF10B (7F4) Mouse mAb [orb1563339]
ICC, IF, WB
Human, Mouse
Monoclonal
Unconjugated
20 μl, 50 μl, 100 μlHuman TNFRSF10B Protein, mFc Tag [orb689451]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 40.5 kDa after removal of the signal peptide.
Mammalian
50 μg, 100 μg, 10 μgMouse TNFRSF10B Protein, hFc Tag [orb1290884]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 40.3 kDa after removal of the signal peptide. The apparent molecular mass of mTNFRSF10B-hFc is approximately 40-55 kDa due to glycosylation.
Mammalian
100 μg, 50 μg, 10 μgTnfrsf10b (NM_020275) Mouse Recombinant Protein [orb3040980]
> 80% as determined by SDS-PAGE and Coomassie blue staining
42.6 kDa
100 μg, 1 mg, 20 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Mouse Tnfrsf10b protein (orb594858)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review





