You have no items in your shopping cart.
PHI, rat
SKU: orb2693550
Description
Images & Validation
−
Key Properties
−| Target | others |
|---|---|
| Molecular Weight | 3011.45 |
| Protein Sequence | HADGVFTSDYSRLLGQISAKKYLESLI-NH2 |
| Purity | ≥95% |
Storage & Handling
−| Disclaimer | For research use only |
|---|
Similar Products
−
Rat Glucose 6 Phosphate Isomerase (GPI) ELISA Kit [orb2667733]
Rat
0.16-10 ng/mL
0.054 ng/mL
48 T, 96 T- Item 1 of 1
Rat Glucose-6-phosphate isomerase Protein [orb1476964]
Greater than 90% as determined by SDS-PAGE.
70.1 kDa
E.coli
1 mg, 100 μg, 20 μg - Item 1 of 1
Recombinant Rat Glucose-6-phosphate isomerase (Gpi) [orb1674605]
Greater than 90% as determined by SDS-PAGE.
63.8 kDa
Yeast
1 mg, 100 μg, 20 μg 
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
Gene Symbol
others
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
PHI, rat (orb2693550)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review