(Pro3) Gastric Inhibitory Peptide (GIP), human

SKU: orb2693935

Description

(Pro3) GIP, human ((Pro3) Gastric Inhibitory Peptide, human) is an efficacious, stable and specific human GIP receptor (hGIPR) full agonist. (Pro3) GIP, human has high binding affinity for human GIPR with Ki/ Kd values of 0.90 nM. (Pro3) GIP, human can be used for the research of obesity-related diabetes.

Images & Validation

−

Key Properties

−

Target	Insulin Receptor
Molecular Weight	4951.53
Protein Sequence	YAPGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Purity	≥95%

Storage & Handling

−

Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links

Gene Symbol

Insulin Receptor

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols