Recombinant Human Tumor necrosis factor ligand superfamily member 11 (TNFSF11), partial

SKU: orb1096081

Featured

Description

This Recombinant Human Tumor necrosis factor ligand superfamily member 11 (TNFSF11), partial spans the amino acid sequence from region 63-244aa & linker(NKLLVPRGSPGSGYIPEAPRDGQAYVRKDGEWVLLSTFLG). Purity: Greater than 85% as determined by SDS-PAGE.

Research Area

Cardiovascular Research

Images & Validation

−

Item 1 of 1

Application Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

−

Source	Mammalian cell
Biological Origin	Homo sapiens (Human)
Tag	N-terminal 10xHis-tagged
Molecular Weight	27.5 kDa
Expression Region	63-244aa&linker(NKLLVPRGSPGSGYIPEAPRDGQAYVRKDGEWVLLSTFLG)
Protein Length	Partial of Isoform2
Protein Sequence	GSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDIDNKLLVPRGSPGSGYIPEAPRDGQAYVRKDGEWVLLSTFLG
Purity	Greater than 85% as determined by SDS-PAGE.

Storage & Handling

−

Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Form/Appearance	Liquid or Lyophilized powder
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

Osteoclast differentiation factor, ODF, Osteoprotegerin ligand, OPGL, Receptor activator of nuclear factor kappa-B ligand, RANKL, TNF-related activation-induced cytokine, TRANCE, CD254

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Recombinant Human Tumor necrosis factor ligand superfamily member 11 (TNFSF11), partial

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Quick Database Links

UniProt

O14788

UniProt Details

−

No UniProt data available

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols