You have no items in your shopping cart.
RecombinantHB-EGF,Human
SKU: orb1494730
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | CHO |
|---|---|
| Biological Activity | ED50 < 0.5 ng/ml, measured in a cell proliferation assay using 3T3 cells. |
| Molecular Weight | 12-14 kDa, observed by reducing SDS-PAGE. |
| Protein Sequence | DLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGER CHGLSL |
| Purification | > 95% as analyzed by SDS-PAGE and HPLC. |
| Purity | > 95% as analyzed by SDS-PAGE and HPLC. |
| Endotoxins | < 0.2 EU/μg, determined by LAL method. |
Storage & Handling
−| Storage | Lyophilized recombinant Human HB-EGF remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human HB-EGF should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
|---|---|
| Form/Appearance | Lyophilized after extensive dialysis against PBS. |
| Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−DTR, DTS, HEGFL
Similar Products
−RecombinantHB-EGF,Human [orb1494849]
> 95% as analyzed by SDS-PAGE.
14 kDa, observed by reducing SDS-PAGE.
Escherichia coli.
1 mg, 10 μg, 50 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
RecombinantHB-EGF,Human (orb1494730)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review