Cart summary

You have no items in your shopping cart.

RecombinantIL-3,Human(CHO-expressed)

SKU: orb1494707

Description

Interleukin-3 (IL-3) is a hematopoietic growth factor that promotes the survival, differentiation and proliferation of committed progenitor cells of the megakaryocyte, granulocyte-macrophage, erythroid, eosinophil, basophil and mast cell lineages. Produced by T cells, mast cells and eosinophils, IL-3 enhances thrombopoieses, phagocytosis, and antibody-mediated cellular cytotoxicity. Its ability to activate monocytes suggests that IL-3 may have additional immunoregulatory roles. Many of the IL-3 activities depend upon co-stimulation with other cytokines. IL-3 is species-specific, variably glycosylated cytokine.Recombinant human interleukin 3 expressed in CHO cells is glycosylated protein with molecular weight range from 17 to 30 kDa shown in non-reducing SDS-PAGE.

Images & Validation

Application Notes
Reconstituted in ddH2O or PBS at 100 μg/ml.

Key Properties

SourceCHO
Biological ActivityED50 1×10ˆ7 units/mg.
Molecular Weight17-30 kDa, observed by non-reducing SDS-PAGE.
Protein SequenceAPMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKN LLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
Purification> 95% as analyzed by SDS-PAGE and HPLC.
Purity> 95% as analyzed by SDS-PAGE and HPLC.
Endotoxins< 0.2 EU/μg, determined by LAL method.

Storage & Handling

StorageLyophilized recombinant human Interlerkin 3 (IL-3) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhIL-3 should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Form/AppearanceLyophilized after extensive dialysis against PBS.
Buffer/PreservativesLyophilized after extensive dialysis against PBS.
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Interleukin-3, IL3
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

RecombinantIL-3,Human(CHO-expressed) (orb1494707)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

10 μg
$ 180.00
50 μg
$ 450.00