Cart summary

You have no items in your shopping cart.

SARS-CoV-2 (COVID-19) NTD Recombinant Protein

SKU: orb1231619

Description

SARS-CoV-2 (COVID-19) NTD Recombinant Protein

Research Area

Infectious Disease & Virology

Images & Validation

Tested ApplicationsELISA
Application Notes
ELISA

Key Properties

SourceHEK293 cells
Molecular WeightThe predicted molecular mass is ~36 kDa.
Protein SequenceVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGT KRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCND PFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNID GYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAG AAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKS
Purity>95% by SDS Page

Storage & Handling

StorageThis recombinant protein may be stored as received at 2-8°C for up to one month. For longer term storage, aseptically aliquot in working volumes without diluting and store at -80°C. Avoid Repeated Freeze Thaw Cycles.
Form/AppearanceLiquid
Buffer/PreservativesThis recombinant protein is aseptically packaged and formulated in 0.01 M phosphate buffered saline (PBS) pH 7.2 - 7.4, 150 mM NaCl with no carrier protein, potassium, calcium or preservatives added._x000D_ _x000D_
Concentration0.5 mg/ml
Expiration Date6 months from date of receipt.
Dry Ice ShippingPlease note: This product requires shipment on dry ice. A dry ice surcharge will apply.
DisclaimerFor research use only

Similar Products

  • SARS-CoV-2 (COVID-19) S1 Recombinant Protein NTD [orb1231454]

    ELISA,  WB

    >90% as determined by SDS-PAGE.

    34.9 kDa

    HEK293 cells

    0.1 mg
  • SARS-CoV-2 (2019-nCoV) S1 protein NTD, His Tag [orb689470]

    Unconjugated

    The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.

    The protein has a predicted molecular mass of 33.7 kDa after removal of the signal peptide. The apparent molecular mass of S1-NTD-His is approximately 55 kDa due to glycosylation.

    Mammalian

    10 μg, 100 μg, 50 μg
  • SARS-CoV-2 (2019-nCoV) S1 protein NTD, mFc Tag [orb689471]

    Unconjugated

    The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.

    The protein has a predicted molecular mass of 59.1 kDa after removal of the signal peptide.The apparent molecular mass of S1-NTD-mFc is approximately 70-100 kDa due to glycosylation.

    Mammalian

    50 μg, 10 μg, 100 μg
  • SARS-CoV-2 (2019-nCoV) S1 protein NTD, hFc Tag [orb689472]

    Unconjugated

    The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.

    The protein has a predicted molecular mass of 59.0 kDa after removal of the signal peptide. The apparent molecular mass of S1-NTD-hFc is approximately 70-100 kDa due to glycosylation.

    Mammalian

    10 μg, 100 μg, 50 μg
  • Recombinant Human COVID-19/SARS-CoV-2 NTD Protein Monoclonal Antibody [orb1141370]

    ELISA

    Recombinant

    Unconjugated

    500 μg, 100 μg, 1 mg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

SARS-CoV-2 (COVID-19) NTD Recombinant Protein

Purified SARS-CoV-2 N-Terminal Domain (NTD) Spike Protein under non-reducing conditions. Lane 1-NTD Protein loaded at 10 μg.

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

ELISA
Enzyme-linked Immunosorbent Assay (EIA)
View Protocol

SARS-CoV-2 (COVID-19) NTD Recombinant Protein (orb1231619)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet