You have no items in your shopping cart.
SARS-CoV-2 NSP3/SARS Rabbit Polyclonal Antibody (Fluoro488)
SKU: orb3091660
Description
Research Area
Protein Biochemistry, Signal Transduction
Images & Validation
−
| Tested Applications | FC |
|---|---|
| Dilution Range | Flow Cytometry, 1-3μg/1x10^6 cells |
| Reactivity | Human |
Key Properties
−| Antibody Type | Primary Antibody |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | Rabbit IgG |
| Immunogen | HSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIALK |
| Target | T-cell surface glycoprotein CD3 zeta chain |
| Molecular Weight | 16693 Da |
| Purification | Immunogen affinity purified. |
| Conjugation | Fluoro488 |
Storage & Handling
−| Storage | At -20°C for one year from date of receipt. Avoid repeated freezing and thawing. Protect from light. |
|---|---|
| Form/Appearance | Liquid |
| Buffer/Preservatives | Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3. |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Replicase polyprotein 1ab; pp1ab; ORF1ab polyprotein; nsp10; Non-structural protein 10; Growth factor-like peptide; GFL; rep

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Documents Download
Datasheet
Product Information
Request a Document
SARS-CoV-2 NSP3/SARS Rabbit Polyclonal Antibody (Fluoro488) (orb3091660)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review