Cart summary

You have no items in your shopping cart.

PDCD8 Rabbit Polyclonal Antibody

SKU: orb324833

Description

Rabbit polyclonal antibody to AIFM1

Research Area

Cell Biology, Epigenetics & Chromatin

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Sheep, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human PDCD8
TargetAIFM1
Protein SequenceSynthetic peptide located within the following region: VDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPST
Molecular Weight36kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti AIF antibody, anti PDCD8 antibody, anti COXPD6 antibody

Similar Products

  • AIF/AIFM1 Rabbit Polyclonal Antibody [orb251549]

    FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • AIF-M1 rabbit pAb Antibody [orb764490]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • AIFM1 Rabbit Polyclonal Antibody [orb592665]

    WB

    Bovine, Canine, Equine, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • AIF Rabbit Polyclonal Antibody [orb10071]

    WB

    Bovine, Canine, Gallus, Human, Porcine, Rabbit, Rat, Sheep

    Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • AIFM1 Rabbit Polyclonal Antibody [orb624571]

    ELISA,  IF,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

PDCD8 Rabbit Polyclonal Antibody

AIFM1 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb324833 with 1:200 dilution. Western blot was performed using orb324833 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: AIFM1 IP with orb324833 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

PDCD8 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/mL.

PDCD8 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/mL.

PDCD8 Rabbit Polyclonal Antibody

Rabbit Anti-AIFM1 Antibody, Catalog Number: orb324833, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, nucleus, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.

PDCD8 Rabbit Polyclonal Antibody

Rabbit Anti-AIFM1 Antibody, Catalog Number: orb324833, Formalin Fixed Paraffin Embedded Tissue: Human Kidney Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.

PDCD8 Rabbit Polyclonal Antibody

WB Suggested Anti-PDCD8 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate, AIFM1 is supported by BioGPS gene expression data to be expressed in Jurkat.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_665812

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

PDCD8 Rabbit Polyclonal Antibody (orb324833)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry