You have no items in your shopping cart.
SARS-CoV-2 ORF8 Antibody Cy3 Conjugated
SKU: orb2602828
Description
Images & Validation
−
| Tested Applications | FC |
|---|---|
| Reactivity | Human |
| Application Notes |
Key Properties
−| Antibody Type | Primary Antibody |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | Rabbit IgG |
| Immunogen | AAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI |
| Molecular Weight | 16693 Da |
| Purification | Immunogen affinity purified. |
| Conjugation | Cy3 |
Storage & Handling
−| Storage | At -20°C for one year from date of receipt. Avoid repeated freezing and thawing. Protect from light. |
|---|---|
| Form/Appearance | Liquid |
| Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
| Disclaimer | For research use only |
Alternative Names
−ORF8 protein; ORF8; Non-structural protein 8; ns8

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
SARS-CoV-2 ORF8 Antibody Cy3 Conjugated (orb2602828)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review