You have no items in your shopping cart.
Apelin 36 (human)
SKU: orb1140484
Description
Images & Validation
−
Key Properties
−| Molecular Weight | 4195.87 Da |
|---|---|
| Protein Sequence | H-Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH |
| Purity | > 95% by hplc |
Storage & Handling
−| Storage | Store dry, frozen and in the dark |
|---|---|
| Form/Appearance | Freeze dried solid |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−, 252642-12-9, Apelin-36 (human), Apelin36 (human), LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
Similar Products
−Apelin/APLN Rabbit Polyclonal Antibody [orb47968]
WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Apelin 36 (human) (orb1140484)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review


