You have no items in your shopping cart.
Ataxin 1 Antibody (Biotin)
Description
Research Area
Images & Validation
−| Tested Applications | ICC, IF, IHC, IP, WB |
|---|---|
| Dilution range | WB (1:1000), ICC/IF (1:100) |
| Reactivity | Human, Mouse, Rat |
| Application Notes |
Key Properties
−| Host | Mouse |
|---|---|
| Clonality | Monoclonal |
| Isotype | IgG2b |
| Clone No. | N76/8 (Formerly sold as S76-8) |
| Immunogen | Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). |
| Target | Ataxin 1 |
| Molecular Weight | 85kDa |
| Purification | Protein G Purified |
| Conjugation | Biotin |
Storage & Handling
−| Storage | Conjugated antibodies should be stored according to the product label |
|---|---|
| Buffer/Preservatives | 136.36mM Ethanolamine, 133.23 mM Chlorides, 9.55mM Phosphates, 9.55mM Sodium Bicarbonate |
| Concentration | 1 mg/ml |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Immunocytochemistry/Immunofluorescence analysis using Mouse Anti-Ataxin 1 Monoclonal Antibody, Clone N76/8. Tissue: Neuroblastoma cells (SH-SY5Y). Species: Human. Fixation: 4% PFA for 15 min. Primary Antibody: Mouse Anti-Ataxin 1 Monoclonal Antibody at 1:100 for overnight at 4°C with slow rocking. Secondary Antibody: AlexaFluor 488 at 1:1000 for 1 hour at RT. Counterstain: Phalloidin-iFluor 647 (red) F-Actin stain; Hoechst (blue) nuclear stain at 1:800, 1.6mM for 20 min at RT. (A) Hoechst (blue) nuclear stain. (B) Phalloidin-iFluor 647 (red) F-Actin stain. (C) Ataxin 1 Antibody (D) Composite.

Immunocytochemistry/Immunofluorescence analysis using Mouse Anti-Ataxin 1 Monoclonal Antibody, Clone N76/8. Tissue: Neuroblastoma cell line (SK-N-BE). Species: Human. Fixation: 4% Formaldehyde for 15 min at RT. Primary Antibody: Mouse Anti-Ataxin 1 Monoclonal Antibody at 1:100 for 60 min at RT. Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1:200 for 60 min at RT. Counterstain: Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain at 1:1000, 1:5000 for 60 min at RT, 5 min at RT. Localization: Cytoplasm, Nucleus. Magnification: 60X. (A) DAPI (blue) nuclear stain. (B) Phalloidin Texas Red F-Actin stain. (C) Ataxin 1 Antibody. (D) Composite.
Quick Database Links
UniProt Details
−NCBI Gene Details
−NCBI Reference Sequences
−| Protein | NP_001186233.1 |
|---|
Documents Download
Request a Document
Protocol Information
Ataxin 1 Antibody (Biotin) (orb150777)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review


