Cart summary

You have no items in your shopping cart.

BDNF Rabbit Polyclonal Antibody

SKU: orb578294

Description

Rabbit polyclonal antibody to BDNF

Research Area

Disease Biomarkers, Neuroscience, Signal Transduction

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Monkey, Mouse
Predicted ReactivityCanine, Equine, Porcine, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human BDNF
TargetBDNF
Protein SequenceSynthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG
Molecular Weight28 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

ANON2, BULN2

Similar Products

  • BDNF Rabbit Polyclonal Antibody [orb155815]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Trk B (phospho Tyr516) rabbit pAb Antibody [orb769304]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • Trk B rabbit pAb Antibody [orb769307]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl
  • TrkB Rabbit Polyclonal Antibody [orb11517]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Mouse

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 50 μl, 100 μl
  • Phospho-TrkB (Tyr515) Rabbit Polyclonal Antibody [orb7122]

    IF,  IHC-Fr,  IHC-P

    Canine, Equine, Gallus, Human, Porcine, Rabbit

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 50 μl, 200 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

BDNF Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.The canonical isoform of 28 kDa is present as well as a second isoform around 37 kDa. Several isoforms of similar size contain this peptide sequence.

BDNF Rabbit Polyclonal Antibody

Sample Tissue: Mouse Brain, Antibody Dilution: 1 ug/ml.

BDNF Rabbit Polyclonal Antibody

Sample Tissue: Mouse Pancreas, Antibody Dilution: 1 ug/ml.

BDNF Rabbit Polyclonal Antibody

Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/ml.

BDNF Rabbit Polyclonal Antibody

Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 3 ug/ml.

BDNF Rabbit Polyclonal Antibody

Sample Tissue: Human ACHN, Antibody Dilution: 1.0 ug/ml.

BDNF Rabbit Polyclonal Antibody

Sample Tissue: Human HT1080 Whole Cell, Antibody Dilution: 1 ug/ml.

BDNF Rabbit Polyclonal Antibody

Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/ml.

BDNF Rabbit Polyclonal Antibody

Sample Tissue: Human Ovary Tumor, Antibody Dilution: 1 ug/ml.

BDNF Rabbit Polyclonal Antibody

Sample Tissue: Human PANC1 Whole Cell, Antibody Dilution: 3 ug/ml.

BDNF Rabbit Polyclonal Antibody

Sample Type: ACHN Whole Cell lysates, Antibody Dilution: 1.0 ug/ml.

BDNF Rabbit Polyclonal Antibody

Sample Type: ACHN Whole Cell lysates, Antibody Dilution: 1 ug/ml.

BDNF Rabbit Polyclonal Antibody

Sample Type: Fetal Liver lysates, Antibody Dilution: 0.5 ug/ml.

BDNF Rabbit Polyclonal Antibody

Sample Type: Rhesus macaque spinal cord, Primary Antibody Dilution: 1:300, Secondary Antibody: Donkey anti Rabbit 488, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: Green: BDNF, Gene Name: BDNF.

BDNF Rabbit Polyclonal Antibody

Sample Type: Ventral horn region of mouse spinal cord, Primary Antibody Dilution: 1:200, Secondary Antibody: Donkey anti-rabbit CY2, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: Green:BDNF, Gene Name: BDNF.

BDNF Rabbit Polyclonal Antibody

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

BDNF Rabbit Polyclonal Antibody

WB Suggested Anti-BDNF Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Liver.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_001700

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

BDNF Rabbit Polyclonal Antibody (orb578294)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry