Cart summary

You have no items in your shopping cart.

Canine IL-1 beta protein

SKU: orb1215717

Description

The Canine IL-1 beta Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine IL-1 beta Biotinylated applications are for cell culture. Canine IL-1 beta Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Canine IL-1 beta Biotinylated Specifications: (Molecular Weight: 17.5 kDa) (Amino Acid Sequence: AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS) (Gene ID: 403974).

Images & Validation

Key Properties

SourceYeast
Biological OriginCanine
TargetIL-1 beta
Molecular Weight17.5 kDa
Protein Length152.0
Protein SequenceAAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS
Purity98%

Storage & Handling

Storage-20°C
Form/AppearanceLyophilized
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

IL-1F2

Similar Products

  • Canine IL-1 beta protein [orb1216339]

    98%

    17.5 kDa

    Yeast

    5 μg, 25 μg, 500 μg, 100 μg
  • Canine IL-1b protein [orb633354]

    ELISA,  WB

    Greater than 95% by SDS-PAGE gel analyses

    17.4 KDa

    E.Coli

    100 μg, 50 μg, 200 μg, 1 mg
  • Canine IL-1 beta ELISA Kit [orb1216637]

    Canine

    1 set (2 x capture antibody), 1 set (1 x capture antibody)
  • Canine k9IL1B Protein [orb752949]

    Greater than 95.0% as determined by SDS-PAGE.

    Escherichia Coli

    100 μg, 10 μg, 2 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Canine IL-1 beta protein (orb1215717)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

10 μg
$ 340.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry