You have no items in your shopping cart.
Canine IL-1 beta protein
SKU: orb1215717
Description
Images & Validation
−
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Canine |
| Target | IL-1 beta |
| Molecular Weight | 17.5 kDa |
| Protein Length | 152.0 |
| Protein Sequence | AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS |
| Purity | 98% |
Storage & Handling
−| Storage | -20°C |
|---|---|
| Form/Appearance | Lyophilized |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−IL-1F2
Similar Products
−Canine IL-1b protein [orb633354]
ELISA, WB
Greater than 95% by SDS-PAGE gel analyses
17.4 KDa
E.Coli
100 μg, 50 μg, 200 μg, 1 mgCanine IL-1 beta ELISA Kit [orb1216637]
Canine
1 set (2 x capture antibody), 1 set (1 x capture antibody)Canine k9IL1B Protein [orb752949]
Greater than 95.0% as determined by SDS-PAGE.
Escherichia Coli
100 μg, 10 μg, 2 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
Gene Symbol
IL-1 beta
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Canine IL-1 beta protein (orb1215717)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review