Canine IL-1ra protein

SKU: orb1216235

Description

The Canine IL-1 Receptor Antagonist yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine IL-1 Receptor Antagonist applications are for cell culture, ELISA standard, and Western Blot Control. The Canine IL-1 Receptor Antagonist yeast-derived recombinant protein can be purchased in multiple sizes. Canine IL-1 Receptor Antagonist Specifications: (Molecular Weight: 16.8 kDa) (Amino Acid Sequence: LGKRPCRMQAFRIWDVNQKTFYLRNNQLVAGYLQGSNTKLEEKLDVVPVEPHAVFLGIHGGKLCLACVKSGDETRLQLEAVNITDLSKNKDQDKRFTFILSDSGPTTSFESAACPGWFLCTALEADRPVSLTNRPEEAMMVTKFYFQKE (149)) (Gene ID: 403660).

Images & Validation

−

Key Properties

−

Source	Yeast
Biological Origin	Canine
Target	IL-1ra
Molecular Weight	16.8 kDa
Protein Length	149.0
Protein Sequence	LGKRPCRMQAFRIWDVNQKTFYLRNNQLVAGYLQGSNTKLEEKLDVVPVEPHAVFLGIHGGKLCLACVKSGDETRLQLEAVNITDLSKNKDQDKRFTFILSDSGPTTSFESAACPGWFLCTALEADRPVSLTNRPEEAMMVTKFYFQKE (149)
Purity	98%

Storage & Handling

−

Storage	-20°C
Form/Appearance	Lyophilized
Disclaimer	For research use only

Alternative Names

−

IL-1F3

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links

Gene Symbol

IL-1ra

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols