Cart summary

You have no items in your shopping cart.

Canine IL-6 protein

SKU: orb1216333

Description

The Canine IL-6 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine IL-6 applications are for cell culture, ELISA standard, and Western Blot Control. The Canine IL-6 yeast-derived recombinant protein can be purchased in multiple sizes. Canine IL-6 Specifications: (Molecular Weight: 20.0 kDa) (Amino Acid Sequence: FPTPGPLAGDSKDDATSNSLPLTSANKVEELIKYILGKISALRKEMCDKFNKCEDSKEALAENNLHLPKLEGKDGCFQSGFNQETCLTRITTGLVEFQLHLNILQNNYEGDKENVKSVHMSTKILVQMLKSKVKNQDEVTTPDPTTDASLQAILQSQDEWLKHTTIHLILRSLEDFLQFSLRAVRIM) (Gene ID: 403985).

Images & Validation

Key Properties

SourceYeast
Biological OriginCanine
TargetIL-6
Molecular Weight21.0 kDa
Protein Length187.0
Protein SequenceFPTPGPLAGDSKDDATSNSLPLTSANKVEELIKYILGKISALRKEMCDKFNKCEDSKEALAENNLHLPKLEGKDGCFQSGFNQETCLTRITTGLVEFQLHLNILQNNYEGDKENVKSVHMSTKILVQMLKSKVKNQDEVTTPDPTTDASLQAILQSQDEWLKHTTIHLILRSLEDFLQFSLRAVRIM
Purity98%

Storage & Handling

Storage-20°C
Form/AppearanceLyophilized
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Similar Products

  • Canine IL-6 protein [orb633440]

    ELISA,  WB

    Greater than 95% by SDS-PAGE gel analyses

    22.8 KDa

    E.Coli

    50 μg, 100 μg, 200 μg, 1 mg
  • Canine IL6 Protein [orb426617]

    Greater than 95.0% as determined by SDS-PAGE.

    Sf9, Baculovirus cells

    1 mg, 10 μg, 2 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Canine IL-6 protein (orb1216333)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

5 μg
$ 300.00
25 μg
$ 540.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry