You have no items in your shopping cart.
Canine IL-8 protein
Description
Images & Validation
−
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Canine |
| Target | IL-8 |
| Molecular Weight | 8.6 kDa |
| Protein Length | 74.0 |
| Protein Sequence | VSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFNGNEVCLDPKEKWVQKVVQIFLKKAEKQDP |
| Purity | 98% |
Storage & Handling
−| Storage | -20°C |
|---|---|
| Form/Appearance | Lyophilized |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Recombinant Canine Interleukin-8/CXCL8 [orb1906147]
> 95 % by SDS-PAGE and HPLC analyses.
Approximately 9.1 kDa, a single non-glycosylated polypeptide chain containing 79 amino acids.
Escherichia coli
5 μg, 100 μg, 500 μgCanine IL-8 protein [orb633364]
ELISA, WB
Greater than 95% by SDS-PAGE gel analyses
9.1 KDa
E.Coli
200 μg, 1 mg, 100 μg, 50 μgk9IL8 Protein [orb1471905]
Greater than 90.0% as determined by SDS-PAGE.
HEK293 Cells
100 μg, 10 μg, 2 μgCanine IL 8 Protein [orb429416]
Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Escherichia Coli
5 μg, 1 mg, 20 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
Documents Download
Request a Document
Protocol Information
Canine IL-8 protein (orb1216335)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review
