Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Casp2 Rabbit Polyclonal Antibody

SKU: orb584187

Description

Rabbit polyclonal antibody to Casp2

Research Area

Cell Biology

Images & Validation

Tested ApplicationsWB
ReactivityMouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Mouse Casp2
TargetCasp2
Protein SequenceSynthetic peptide located within the following region: DNANCPSLQNKPKMFFIQACRGDETDRGVDQQDGKNHTQSPGCEESDAGK
Molecular Weight51kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Casp, Ich-, Nedd, ICH-1, Nedd2, CASP-2, NEDD-2

Similar Products

  • Caspase-2/CASP2 Rabbit Polyclonal Antibody [orb443153]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • Caspase-2 p13 Rabbit Polyclonal Antibody [orb526489]

    IF,  IHC-Fr,  IHC-P

    Equine, Mouse, Porcine, Rabbit, Sheep

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Cleaved-Caspase-2 p18 (G170) rabbit pAb Antibody [orb763891]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • Caspase-2 p18 Rabbit Polyclonal Antibody [orb499800]

    IF,  IHC-Fr,  IHC-P

    Bovine, Equine, Porcine, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 50 μl, 100 μl
  • Cleaved-Caspase-2 p18 (T325) rabbit pAb Antibody [orb770559]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Casp2 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.

Casp2 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.

Casp2 Rabbit Polyclonal Antibody

Sample Type: Mouse Testis lysates, Antibody dilution: 1.0 ug/ml.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_031636

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

Casp2 Rabbit Polyclonal Antibody (orb584187)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry